Noxiustoxin
This article, Noxiustoxin, has recently been created via the Articles for creation process. Please check to see if the reviewer has accidentally left this template after accepting the draft and take appropriate action as necessary.
Reviewer tools: Inform author |

Noxiustoxin (NTX) is one of the best-studied toxic peptides from scorpion venoms[1]. It was the second purified toxin of the Centruroides genus after neurotoxin II[2] and the first short peptide from scorpion venom to be reported in the literature[3]. The name for noxiustoxin was first proposed in 1982[4], before which it was known as toxin II-11[3].
Synonyms | NTx; NXT; NXT-1; Toxin II.11; Potassium channel toxin alpha-KTx 2.1[5] |
Organism | Centruroides noxius Hoffmann (Mexican scorpion)[4] |
CAS Number | 85205-49-8 (143074-44-6)[6] |
Protein Data Bank | 1SXM[7] |
UniProt ID | P08815[8] |
Molar Mass | 4195.06[5] |
Chemical Formula | C174H286N52O54S7[6] |
Amino Acid Sequence | TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2[5] |
Source
NTX was first purified from homogenized crude venom extract of the Mexican scorpion Centruroides noxius Hoffmann[4], found in the Mexican state of Nayarit[1]. NTX accounts for only about 1% of the scorpion venom[9].
Chemistry
NTX is a peptide consisting of 39 amino acid residues. It has a molar mass of 4195.06 and the following primary amino acid sequence: TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2[5]. The sequence of NTX contains no histidine, arginine, tryptophan, or phenylalanine. NTX has three disulphide bridges[4] and contains an amidated C-terminus[10]. NTX is similar in sequence to the margatoxin (79% identity), the kaliotoxin (51% identity), the charybdotoxin (49% identity), and the iberiotoxin (38% identity)[10]. The three-dimensional solution structure of NTX has been solved by nuclear magnetic resonance (NMR)[11].
Target
NTX blocks the pore of several types of voltage-gated K+ channels by reversibly binding to the channel receptor site[4]. Furthermore, it affects Ca+ activated K+ channels of skeletal muscles[12]. In the squid axon, NTX was found to have relatively low binding affinity with their target site on the channel protein (KD = 300nM)[3].
Mode of Action
NTX associates reversibly with K+ channels and thus decreases K+ permeability in brain synaptosomes[13]. The location of the active site of NTX is not completely known yet. However, it is believed to be located close to the N-Terminal portion of the toxin as administration of synthetic-nonapeptide NTX1-9, which corresponds to the N-Terminal sequences of NTX, leads to symptoms of intoxication that are very similar to native NTX, while a second synthetic active fragment, corresponding to the C-Terminal of NTX, did not lead to symptoms of intoxication[14].
Furthermore, the mode of action of NTX is thought to be concentration dependent. K+ currents are found to be blocked by NTX at concentrations lower than 1.5 µM in a voltage-independent manner and above 1.5 µM in a voltage-dependent manner[15]. The blocking of K+ channels by NTX is never complete, which indicates that NTX is either not able to fully block a channel or that not all channels have a receptor site for NTX[15].
Toxicity
LD50 of the venom is 0.26µg/g in albino mice after Intraperitoneal injection[16]. Intoxication symptoms of mice include hyperexcitability, lacrimation, convulsions, salivation, dyspnea, and eventually death by respiratory paralysis[14].
Treatment
Although the venom of Centruroides noxius Hoffmann is the most toxic of all the Mexican scorpions[17], it is less medically important, because Centruroides noxius does not cohabitate with humans[18].
Medical significance
It is suggested that due to structural similarity between toxins, a vaccine against Centruroides noxius could be efficient against other, more dangerous, Centruroides species that cause more public health problems[19].
External links
https://www.ncbi.nlm.nih.gov/Structure/mmdb/mmdbsrv.cgi?Dopt=s&uid=74293
http://www.ebi.ac.uk/pdbe/entry/pdb/1sxm
References
- ^ a b Possani, Lourival D; Corona, Miguel; Zurita, Mario; Rodrı́guez, Mario H. "From Noxiustoxin to Scorpine and Possible Transgenic Mosquitoes Resistant to Malaria". Archives of Medical Research. 33 (4): 398–404. doi:10.1016/s0188-4409(02)00370-3.
- ^ Jover, E.; Couraud, F.; Rochat, H. (1980-08-29). "Two types of scorpion neurotoxins characterized by their binding to two separate receptor sites on rat brain synaptosomes". Biochemical and Biophysical Research Communications. 95 (4): 1607–1614. ISSN 0006-291X. PMID 7417336.
- ^ a b c Carbone, Emilio; Wanke, Enzo; Prestipino, Gianfranco; Possani, Lourival D.; Maelicke, Alfred (1982-03-04). "Selective blockage of voltage-dependent K+ channels by a novel scorpion toxin". Nature. 296 (5852): 90–91. doi:10.1038/296090a0.
- ^ a b c d e Possani, Lourival Domingos; Martin, Brian M.; Svendsen, I. B. (1982-09-01). "The primary structure of noxiustoxin: A K+ channel blocking peptide, purified from the venom of the scorpion Centruroides noxius Hoffmann". Carlsberg Research Communications. 47 (5): 285–289. doi:10.1007/bf02907789. ISSN 0105-1938.
- ^ a b c d "Kalium: Scorpion Toxins Active on Potassium Channels". kaliumdb.org. Retrieved 2017-10-09.
- ^ a b "Noxiustoxin | #STN-340 | Alomone labs". www.alomone.com. Retrieved 2017-10-09.
- ^ Dauplais, M.; Gilquin, B.; Possani, L. D.; Gurrola-Briones, G.; Roumestand, C.; Menez, A. (1995). "Determination of the three-dimensional solution structure of noxiustoxin: analysis of structural differences with related short-chain scorpion toxins". Biochemistry. 34: 16563–16573. doi:10.2210/pdb1sxm/pdb.
- ^ "Potassium channel toxin alpha-KTx 2.1 - Centruroides noxius (Mexican scorpion)". www.uniprot.org. Retrieved 2017-10-09.
- ^ Possani, Lourival D; Zurita, Mario; Delepierre, Muriel; Hernández, Fidel H; Rodrguez, Mario H. "From Noxiustoxin to Shiva-3, a peptide toxic to the sporogonic development of Plasmodium berghei". Toxicon. 36 (11): 1683–1692. doi:10.1016/s0041-0101(98)00161-5.
- ^ a b Drakopoulou, E.; Cotton, J.; Virelizier, H.; Bernardi, E.; Schoofs, A.R.; Partiseti, M.; Choquet, D.; Gurrola, G.; Possani, L.D. "Chemical Synthesis, Structural and Functional Characterization of Noxiustoxin, a Powerful Blocker of Lymphocyte Voltage-Dependent K+ Channels". Biochemical and Biophysical Research Communications. 213 (3): 901–907. doi:10.1006/bbrc.1995.2214.
- ^ Dauplais, Marc; Gilquin, Bernard; Possani, Lourival D.; Gurrola-Briones, Georgina; Roumestand, Christian; Menez, Andre (1995-12-01). "Determination of the Three-Dimensional Solution Structure of Noxiustoxin: Analysis of Structural Differences with Related Short-Chain Scorpion Toxins". Biochemistry. 34 (51): 16563–16573. doi:10.1021/bi00051a004. ISSN 0006-2960.
- ^ Valdivia, Hector H.; Smith, Jeffrey S.; Martin, Brian M.; Coronado, Roberto; Possani, Lourival D. (1988-01-04). "Charybdotoxin and noxiustoxin, two homologous peptide inhibitors of the K+(Ca2+) channel". FEBS Letters. 226 (2): 280–284. doi:10.1016/0014-5793(88)81439-x. ISSN 1873-3468.
- ^ Sitges, M.; Possani, L. D.; Bayón, A. (June 1986). "Noxiustoxin, a short-chain toxin from the Mexican scorpion Centruroides noxius, induces transmitter release by blocking K+ permeability". The Journal of Neuroscience: The Official Journal of the Society for Neuroscience. 6 (6): 1570–1574. ISSN 0270-6474. PMID 3012016.
- ^ a b Gurrola, G. B.; Molinar-Rode, R.; Sitges, M.; Bayon, A.; Possani, L. D. (1989). "Synthetic peptides corresponding to the sequence of noxiustoxin indicate that the active site of this K+ channel blocker is located on its amino-terminal portion". Journal of Neural Transmission. 77 (1): 11–20. PMID 2746197.
- ^ a b Carbone, E.; Prestipino, G.; Spadavecchia, L.; Franciolini, F.; Possani, L. D. (May 1987). "Blocking of the squid axon K+ channel by noxiustoxin: a toxin from the venom of the scorpion Centruroides noxius". Pflugers Archiv: European Journal of Physiology. 408 (5): 423–431. ISSN 0031-6768. PMID 2439979.
- ^ Possani, Lourival Domingos; Dent, Myrna A. R.; Martin, Brian M.; Maelicke, Alfred; Svendsen, Ib (1981-07-01). "The amino terminal sequence of several toxins from the venom of the Mexican scorpion Centruroides noxius Hoffmann". Carlsberg Research Communications. 46 (4): 207. doi:10.1007/bf02906498. ISSN 0105-1938.
- ^ Dent, Myrna A.R.; Possani, Lourival D.; Ramírez, Guillermo A.; Fletcher, Paul L. "Purification and characterization of two mammalian toxins from the venom of the Mexican scorpion Centruroides noxius Hoffmann". Toxicon. 18 (3): 343–350. doi:10.1016/0041-0101(80)90015-x.
- ^ Dehesa-Dávila, Manuel; Ramfrez, Angelina N; Zamudio, Fernando Z; Gurrola-Briones, Georgina; Liévano, Arturo; Darszon, Alberto; Possani, Lourival D. "Structural and functional comparison of toxins from the venom of the scorpions Centruroides infamatus infamatus, centruroides limpidus limpidus and Centruroides noxius". Comparative Biochemistry and Physiology Part B: Biochemistry and Molecular Biology. 113 (2): 331–339. doi:10.1016/0305-0491(95)02031-4.
- ^ Hernández, Ricardo; Gazarian, Tatiana G; Hérion, Pascal S; Gazarian, Karlen G. "Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antibodies and peptide mimotopes". Immunology Letters. 80 (2): 97–103. doi:10.1016/s0165-2478(01)00320-0.
This article, Noxiustoxin, has recently been created via the Articles for creation process. Please check to see if the reviewer has accidentally left this template after accepting the draft and take appropriate action as necessary.
Reviewer tools: Inform author |