User:Penal007/sandbox
Chromosome 12 Open Reading Frame 42 (C12orf42) is a protein encoding gene in Homo sapiens.
Gene
[edit]Locus
[edit]The genomic location for this gene is as follows: starts at 103,237,591 bp and ends 103,496,010 bp.[1] The cytogenetic location for C12orf42 is 12q23.2. It is located on the negative strand[2]

mRNA
[edit]Fifteen different mRNAs are made by transcription, fourteen alternative splice variants and one unspliced form.[2]
Protein
[edit]
The protein released by this gene is known as uncharacterized protein C12orf42.[1]There are three isoforms for this protein produced by alternative splicing. The first isoform is a conical sequence. The second isoform differs from the conical sequence by missing 1-95 aa from its sequence. The third isoform differs from the conical sequence for two reasons:[5]
87-107 aa: VFPERTQNSMACKRLLHTCQYGSHHGQATQKLQGAMVLHLEE
108-360 aa: Missing
Secondary Structure
[edit]C12orf42 protein takes on several secondary structures, such as: alpha helices, beta sheets, and random coils. The protein is a soluble protein.[6] Soluble proteins affect the tertiary structure by the the outer part consist of hydrophilic amino acids and interior of the structure consist of hydrophobic side chains.[7] Proteins that are hydrophilic are able to freely float inside a cell, due to the liquid composition of the cytosol.
Subcellular Location
[edit]C12orf42 is an intracellular protein. This is known by the lack of transmembrane domains or signal peptides. This suggests that it is predicted to be a nuclear protein, given the nuclear localization signal (NSL) found: PRDRRPQ at 292 aa and a bipartite KRLIKVCSSAPPRPTRR at 325 aa.

Post-translation Modification
[edit]Predicted post-translation modification sites are seen below in the table. Nuclear proteins are known for having phosphorylation, acetylation, sumoylation and O-GlcNAc, as types of modifications.[8] Phosphorylation affects proteins-protein interaction and stability of the protein[8]. Acetylation promotes protein folding and improves stability[9]. Sumoylation is involved in nuclear-cytosolic transport and DNA repair[8]. Glycosylation present in the nucleus are known as O-GlcNAc, it functions in protein folding and stability[10].
Type of Modification | Amino Acid Position |
Phosphorylation | Ser44,Ser47,Ser58,Ser74,Ser113,Ser115,Ser118,Ser123,Ser130,Ser134,Ser135,Ser205,Ser210,Ser217,
Ser226,Ser238, Ser302,Thr17,Thr45,Thr145,Thr150,Thr228, Thr240,Thr240,Thr291,Thr339,Thr344,Tyr124[11] |
Acetylation | Ser2[12] |
Sumoylation | IPIVS32-36[13] |
O-GlcNAc | Thr45,Ser58,Ser130,Ser135,Ser205,Ser210,
Ser217,Thr339[14] |
Expression
[edit]Tissue Profiles
[edit]Microarray data shows expression of the C12orf42 gene in different tissues throughout the human body. There is high expression in the lymph node, spleen, and thymus.[15] There is also expressed in the brain, bladder, epididymis, and the helper T cell.[15] Therefore, there is statistically significant expression of C12orf42 gene in the nervous system, immune system, and male reproductive system.
In Situ Hybridization
[edit]The table below shows the areas in the mouse brain where C12orf42 is expressed. The gene name for the mouse is 1700113H08Rik, it is the human homolog of C12orf42.[16]

Location # in mouse brain | Area in Brain[17] | Function[18] |
1 | Crus 1, granular layer | Manages body and skeletal movement |
Crus 2, granular layer | ||
Paramedian lobule, molecular | ||
2 | Paraflocculus, granular layer | |
Flocculus, granular layer | ||
3 | Field CA1, pyramidal layer | Sensory areas |
Field CA2, pyramidal layer | ||
Field CA3, pyramidal layer | ||
4 | Piriform area, pyramidal layer | Perception of smell |
Piriform-amygdalar area, pyramidal layer | ||
5 | Cortical amygdalar area, posterior part, lateral zone, layer 2 | Emotional learning/memory |
Cortical amygdalar area, posterior part, Imedial zone, layer 2 |
Homology
[edit]Paralog
[edit]C12orf42 gene has only one other member in its gene family, this gene is known as Neuroligin 4, Y linked gene (NLGN4Y).[19]
Orthologs
[edit]C12orf42 orthologs are mostly mammals. One exception that was found is Pelodiscus Sinensis or more commonly known as the Chinese soft-shell turtle.
Conserved Domain Structure
[edit]The domain structure that is most important is DUF4607, it is conserved in the Eutheria clade in the Mammalia class. The order that it is conserved in is as follows: Artiodactyla, Carnivora, Chiroptera, Lagomorpha, Perissodactyla, Primates, Proboscidea, and Rodentia.
Mammalia Class | genus | species | common name | Date of divergence | acession # | seq length | seq ident | seq similar | Taxa/Paralog |
1 | Homo | H.Sapiens | Human | --------------- | NP_001157710 | 256aa | 89.80% | ***** | Paralog |
2 | Papio | P.Anubis | Olive Baboon | 27.3 mya | XP_009179812 | 353aa | 90% | 93% | Order Primate |
3 | Ovis | O. Aries | Sheep | 95.0 mya | XP_012026728 | 177aa | 64.00% | 68% | Order Artiodactyla |
4 | Oryctolagus | O. Cuniculus | European Rabbit | 90.1 mya | XP_008255213 | 346aa | 61% | 70% | Order Lagomorpha |
5 | Equus | E. Caballus | Horse | 95.0 mya | XP_005606608 | 293aa | 60% | 68% | Order Perissodactyla |
6 | Orcinus | O. Orca | Killer Whale | 95.0 mya | XP_012388341.1 | 322aa | 59% | 67% | Order Cetacea |
7 | Galeopterus | G.Variegatus | Sunda flying lemur | 83.0 mya | XP_008574769.1 | 289aa | 56% | 64% | Order Dermoptera |
8 | Trichechus | T.Manatus | West Indian Manatee | 102.0 mya | XP_012410246 | 348aa | 55% | 63% | Order Sirenia |
9 | Loxodonta | L. Africana | African bush elephant | 102.0 mya | XP_010599824 | 288aa | 54% | 62% | Order Proboscidea |
10 | Pteropus | P.Alecto | Black flying fox | 95.0 mya | ELK10322.1 | 300aa | 52% | 64% | Order Chiroptera |
11 | Condylura | c.Cristata | Star-nose mole | 95.0 mya | XP_004676538.1 | 306aa | 52% | 64% | Order Insectivora |
12 | Ailuropoda | A. Melanoleuca | Giant Panda | 95.0 mya | XP_011218367.1 | 305aa | 51% | 61% | Order Carnivora |
13 | orycteropus | O. Afer | Aardvarks | 102.0 mya | XP_007950592 | 283aa | 49% | 59% | Order Tubulidentata |
14 | Elephantulus | E. Edwardii | Cape Elephant Shrew | 102.0 mya | XP_006888639 | 114aa | 47% | 60% | Order Macroscelidea |
15 | Mus | M. Musculus | Mouse | 90.1 mya | NP_083961 | 327aa | 45% | 57% | Order Rodentia |
16 | Canis | C. Lupus | Dog | 95.0 mya | XP_013974742 | 206aa | 44% | 56% | Order Carnivora |
17 | Dasypus | D. Novemcinctus | Nine-banded armadillo | 102.0 mya | XP_012377498 | 360aa | 41% | 49% | Order Edentata |
Reptillia Class | genus | species | common name | Date of divergence | accession # | seq length | seq ident | seq similar | NOTES |
1 | Pelodiscus | P. Sinensis | Chinese Soft-Shell Turtle | 320.5 mya | XP_014436518 | 618aa | 32% | 42% | Order Testudines |
Clinical Significance
[edit]In a experiment, fine-tiling comparative genomic hybridization (FT-CGH) and ligation-mediated PCR (LM-PCR) were combined.[20] This resulted in the finding of a chromosomal translocation t(12;14)(q23;q11.2) in T-lymphoblastic lymphoma (T-LBL). This occurs during T-receptor delta gene-deleting rearrangement, which is important in T-cell differentiation. This disrupts C12orf42 and it brings the gene ASCL1 closer to the T-cell receptor alpha (TRA) enhancer. This leads the cross-fused gene to encode vital transcription factors that are found in medullary thyroid cancer and small-cell lung cancer.
- ^ a b "http://www.genecards.org/cgi-bin/carddisp.pl?gene=C12orf42#proteins". www.genecards.org. Retrieved 2016-02-29.
{{cite web}}
: External link in
(help)|title=
- ^ a b [email protected], Danielle Thierry-Mieg and Jean Thierry-Mieg, NCBI/NLM/NIH,. "AceView: Gene:C12orf42, a comprehensive annotation of human, mouse and worm genes with mRNAs or ESTsAceView". www.ncbi.nlm.nih.gov. Retrieved 2016-05-03.
{{cite web}}
: CS1 maint: extra punctuation (link) CS1 maint: multiple names: authors list (link) - ^ "Chromosome 12: 103,237,591-103,496,010 - Region in detail - Homo sapiens - Ensembl genome browser 84". www.ensembl.org. Retrieved 2016-04-26.
- ^ "I-TASSER results". zhanglab.ccmb.med.umich.edu. Retrieved 2016-05-03.
- ^ "C12orf42 - Uncharacterized protein C12orf42 - Homo sapiens (Human) - C12orf42 gene & protein". www.uniprot.org. Retrieved 2016-05-03.
- ^ "SOSUI/submit a protein sequence". harrier.nagahama-i-bio.ac.jp. Retrieved 2016-04-30.
- ^ Berg, Jeremy M.; Tymoczko, John L.; Stryer, Lubert (2002-01-01). "Summary".
{{cite journal}}
: Cite journal requires|journal=
(help) - ^ a b c Dahan, Jennifer; Koen, Emmanuel; Dutartre, Agnes; Lamotte, Olivier; Bourque, Stephane (2011-08-29). Post-Translational Modifications of Nuclear Proteins in the Response of Plant Cells to Abiotic Stresses. InTech. doi:10.5772/23822.
- ^ "Post-translational modification". Wikipedia, the free encyclopedia. 2016-04-06.
- ^ "Glycosylation". Wikipedia, the free encyclopedia. 2016-03-30.
- ^ "NetPhos 2.0 Server". www.cbs.dtu.dk. Retrieved 2016-05-03.
- ^ "NetAcet 1.0 Server". www.cbs.dtu.dk. Retrieved 2016-05-03.
- ^ "GPS-SUMO: Prediction of SUMOylation Sites & SUMO-interaction Motifs". sumosp.biocuckoo.org. Retrieved 2016-05-03.
- ^ "YinOYang 1.2 Server". www.cbs.dtu.dk. Retrieved 2016-05-03.
- ^ a b "GDS3834 / 17229". www.ncbi.nlm.nih.gov. Retrieved 2016-05-02.
- ^ "1700113H08Rik MGI Mouse Gene Detail - MGI:1923890 - RIKEN cDNA 1700113H08 gene". www.informatics.jax.org. Retrieved 2016-05-02.
- ^ a b "Gene Detail :: Allen Brain Atlas: Mouse Brain". mouse.brain-map.org. Retrieved 2016-04-28.
- ^ "Chapter 8B: Cerebellar Systems". www.dartmouth.edu. Retrieved 2016-05-02.
- ^ "Human BLAT Search". genome.ucsc.edu. Retrieved 2016-05-03.
- ^ Przybylski, Grzegorz K.; Dittmann, Kathleen; Grabarczyk, Piotr; Dölken, Gottfried; Gesk, Stefan; Harder, Lana; Landmann, Eva; Siebert, Reiner; Schmidt, Christian A. (2010-11-01). "Molecular characterization of a novel chromosomal translocation t(12;14)(q23;q11.2) in T-lymphoblastic lymphoma between the T-cell receptor delta-deleting elements (TRDREC and TRAJ61) and the hypothetical gene C12orf42". European Journal of Haematology. 85 (5): 452–456. doi:10.1111/j.1600-0609.2010.01508.x. ISSN 1600-0609. PMID 20659153.
- ^ Przybylski, Grzegorz K.; Dittmann, Kathleen; Grabarczyk, Piotr; Dölken, Gottfried; Gesk, Stefan; Harder, Lana; Landmann, Eva; Siebert, Reiner; Schmidt, Christian A. (2010-11-01). "Molecular characterization of a novel chromosomal translocation t(12;14)(q23;q11.2) in T-lymphoblastic lymphoma between the T-cell receptor delta-deleting elements (TRDREC and TRAJ61) and the hypothetical gene C12orf42". European Journal of Haematology. 85 (5): 452–456. doi:10.1111/j.1600-0609.2010.01508.x. ISSN 1600-0609. PMID 20659153.